7vp3/4/1:P/1:N

Sequences

>7vp3-a4-m1-cP (length=61) [Search sequence]

STKDRHTKVEGRGRRIRMPAMCAARVFQLTRELGHKSDGETIEWLLQQAEPAVIAATGTG T

>7vp3-a4-m1-cN (length=62) [Search sequence]

TKDRHTKVEGRGRRIRMPAMCAARVFQLTRELGHKSDGETIEWLLQQAEPAVIAATGTGT IP

Structure information

PDB ID	7vp3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of a transcription factor and DNA complex
Assembly ID	4
Resolution	3.003Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	137
Sequence identity between the two chains	0.984
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	P	N
UniProt accession	Q9C9L2	Q9C9L2
Species	3702 (Arabidopsis thaliana)	3702 (Arabidopsis thaliana)
Function annotation	BioLiP:7vp3P	BioLiP:7vp3N

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7vp3-a4-m1-cP_7vp3-a4-m1-cN.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7vp3-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7vp3/1/1:D/1:J 7vp3/2/1:G/1:C 7vp3/3/1:I/1:L 7vp6/1/1:J/1:D