7vrf/1/1:B/1:A

Sequences

>7vrf-a1-m1-cB (length=60) [Search sequence]

SSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSR

>7vrf-a1-m1-cA (length=61) [Search sequence]

SSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSR E

Structure information

PDB ID	7vrf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Oxpecker chromodomain in complex with H3K9me3
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	54
Sequence identity between the two chains	1.0
PubMed citation	36841100

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	A1ZAW9	A1ZAW9
Species	7227 (Drosophila melanogaster)	7227 (Drosophila melanogaster)
Function annotation	BioLiP:7vrfB	BioLiP:7vrfA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7vrf-a1-m1-cB_7vrf-a1-m1-cA.pdb.gz

Full biological assembly Download: 7vrf-assembly1.cif.gz