7wim/4/1:R/1:S

Sequences
>7wim-a4-m1-cR (length=77) [Search sequence]
AFWGVEVGKTFTLKRLHLSQATLGHATNRSILQCNVPLLLCVLTPDKVDSCQLNLEFEEV
IFSVIGPRSVHLTGYFL
>7wim-a4-m1-cS (length=89) [Search sequence]
AFWGVEVKPGKTFTLKNNIRRLHLSQATLGHGTATNRSILQCNVSPLLLCVLTPDKVDSC
QLNLEFEETDEVIFSVIGPRSVHLTGYFL
Structure information
PDB ID 7wim (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Arabidopsis thaliana FKBP43 N-terminal domain
Assembly ID 4
Resolution 2.29Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 63
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID R S
UniProt accession F4J9Q6 F4J9Q6
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7wim-a4-m1-cR_7wim-a4-m1-cS.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7wim-assembly4.cif.gz

[Back to Home]