7wlm/1/1:B/1:C

Sequences

>7wlm-a1-m1-cB (length=201) [Search sequence]

IEFYGPDRALWLGPYSEGAVPSYLTGEFPGDYGWDSAGLSADPETFAANRELELIHARWA
MLGVVGCLTPEALEKYSGVEFGEATWFKAGSQIFAEGGIDYLGNPSLVHAQSILAIVWSQ
VVLMGLAEGYRVSGGPLGEATDPLYPGEAFDPFGFADDPETFSELKIKEIKNGRLAMFAM
FGFFVQALQTGKGPVECWASH

>7wlm-a1-m1-cC (length=201) [Search sequence]

Structure information

PDB ID	7wlm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The Cryo-EM structure of siphonaxanthin chlorophyll a/b type light-harvesting complex II
Assembly ID	1
Resolution	2.8Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	39
Sequence identity between the two chains	1.0
PubMed citation	37082593

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession
Species	3133 (Codium fragile)	3133 (Codium fragile)
Function annotation	BioLiP:7wlmB	BioLiP:7wlmC

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7wlm-a1-m1-cB_7wlm-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7wlm-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7wlm/1/1:A/1:B 7wlm/1/1:A/1:C