7wmc/1/1:A/1:B

Sequences

>7wmc-a1-m1-cA (length=228) [Search sequence]

GFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIG
SGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPAAFDWSPVVTYVCDLEGNRVK
GPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNL
GSLLKPGGFLVIMDALGREAVEAAVKEAGYTIEWFEVIGLFSLVARKL

>7wmc-a1-m1-cB (length=230) [Search sequence]

Structure information

PDB ID	7wmc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of macrocyclic peptide 1 bound to human Nicotinamide N-methyltransferase
Assembly ID	1
Resolution	2.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	88
Sequence identity between the two chains	1.0
PubMed citation	35904556

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P40261	P40261
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7wmcA	BioLiP:7wmcB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7wmc-a1-m1-cA_7wmc-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7wmc-assembly1.cif.gz