7x58/1/1:B/1:H

Sequences
>7x58-a1-m1-cB (length=73) [Search sequence]
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVT
AMDVVYALKRQGR
>7x58-a1-m1-cH (length=73) [Search sequence]
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVT
AMDVVYALKRQGR
Structure information
PDB ID 7x58 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cryo-EM structure of human subnucleosome (open form)
Assembly ID 1
Resolution 3.93Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
PubMed citation 36322721
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B H
UniProt accession P62805 P62805
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7x58B BioLiP:7x58H
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7x58-a1-m1-cB_7x58-a1-m1-cH.pdb.gz
Full biological assembly
Download: 7x58-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7x57/1/1:B/1:H 7yoz/1/1:H/1:B
Other dimers with similar sequences but different poses
  • 2yfw/2/1:D/1:F 2yfw/1/1:B/1:H
  • [Back to Home]