7x7n/1/1:H/1:I

Sequences
>7x7n-a1-m1-cH (length=36) [Search sequence]
DKEWILQKIYEIMRLLDELDEASMRVSDLIYEFMKK
>7x7n-a1-m1-cI (length=36) [Search sequence]
DKEWILQKIYEIMRLLDELDEASMRVSDLIYEFMKK
Structure information
PDB ID 7x7n (database links: RCSB PDB PDBe PDBj PDBsum)
Title 3D model of the 3-RBD up single trimeric spike protein of SARS-CoV2 in the presence of synthetic peptide SIH-5.
Assembly ID 1
Resolution 4.47Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H I
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7x7n-a1-m1-cH_7x7n-a1-m1-cI.pdb.gz
Full biological assembly
Download: 7x7n-assembly1.cif.gz
Similar dimers

[Back to Home]