7xdk/1/1:F/1:K

Sequences

>7xdk-a1-m1-cF (length=214) [Search sequence]

EVQLQQWGAGLLKPSETLSLTCAVYGESFSGYYWSWIRQSPGKGLEWIGQINHSGNTNYN
PSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARELGHDYWGQGTLVTVSSASTKGP
SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP

>7xdk-a1-m1-cK (length=214) [Search sequence]

Structure information

PDB ID	7xdk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM structure of SARS-CoV-2 Delta Spike protein in complex with BA7054 and BA7125 fab
Assembly ID	1
Resolution	3.2Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	19
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	K
UniProt accession
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7xdk-a1-m1-cF_7xdk-a1-m1-cK.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7xdk-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7xdk/1/1:K/1:L 7xdl/1/1:E/1:I 7xdl/1/1:G/1:I
Other dimers with similar sequences but different poses	7xdl/1/1:E/1:G 7xdk/1/1:F/1:L