7xdl/1/1:E/1:G

Sequences

>7xdl-a1-m1-cE (length=215) [Search sequence]

EVQLQQWGAGLLKPSETLSLTCAVYGESFSGYYWSWIRQSPGKGLEWIGQINHSGNTNYN
PSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARELGHDYWGQGTLVTVSSASTKGP
SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK

>7xdl-a1-m1-cG (length=215) [Search sequence]

Structure information

PDB ID	7xdl (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM structure of SARS-CoV-2 Delta Spike protein in complex with BA7208 and BA7125 fab
Assembly ID	1
Resolution	3.08Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	17
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	G
UniProt accession
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7xdl-a1-m1-cE_7xdl-a1-m1-cG.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7xdl-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

7xdk/1/1:F/1:K 7xdk/1/1:K/1:L 7xdl/1/1:E/1:I 7xdl/1/1:G/1:I