7xl7/1/1:B/1:A

Sequences
>7xl7-a1-m1-cB (length=49) [Search sequence]
MKEGFYWIQHNGRVQVAYYTHGVWHLTQGDDICHNGEAEILAGPLEPPI
>7xl7-a1-m1-cA (length=58) [Search sequence]
MKEGFYWIQHNGRVQVAYYTHGVTEDQTIIGVWHLTQGDDICHNGEAEILAGPLEPPI
Structure information
PDB ID 7xl7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Function And Structure Research of Salmonella typhimurium Unknown Functional Protein MicN
Assembly ID 1
Resolution 1.85Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession A0A2J0R8J6 A0A2J0R8J6
Species 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) 90371 (Salmonella enterica subsp. enterica serovar Typhimurium)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7xl7-a1-m1-cB_7xl7-a1-m1-cA.pdb.gz
Full biological assembly
Download: 7xl7-assembly1.cif.gz

[Back to Home]