7xmw/1/1:A/1:B

Sequences

>7xmw-a1-m1-cA (length=70) [Search sequence]

HHHHAMWKCKKCGCDRFYQDITGGISEVLEMDKDGEVLDEIDDVEYGDFSCAKCDNSSSK IQEIAYWDEI

>7xmw-a1-m1-cB (length=72) [Search sequence]

HHHHHAMWKCKKCGCDRFYQDITGGISEVLEMDKDGEVLDEIDDVEYGDFSCAKCDNSSS KIQEIAYWDEIN

Structure information

PDB ID	7xmw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of anti-CRISPR protein AcrVIA2
Assembly ID	1
Resolution	2.59Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	91
Sequence identity between the two chains	1.0
PubMed citation	35512461

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	U2Q5N5	U2Q5N5
Species	888055 (Leptotrichia wadei F0279)	888055 (Leptotrichia wadei F0279)
Function annotation	BioLiP:7xmwA	BioLiP:7xmwB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7xmw-a1-m1-cA_7xmw-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7xmw-assembly1.cif.gz