7xno/1/1:H/1:Y

Sequences

>7xno-a1-m1-cH (length=247) [Search sequence]

MDLNFIQVILVIFVAFLAGVEGILDQFHFHQPVIACTLIGLVTGNLLPCLILGGTLQMIA
LGWANVGAAVAPDAALASIASAIILVLGGQGKAGVTSAIAIAVPLAVAGLLLTIIVRTLA
TGIVHIMDAAAKEGNFRKIEMWQYIAIIMQGVRIAIPAGLILAIGAGPVKEMLTAMPVWL
TDGLAIGGGMVVAVGYAMVINMMATKEVWPFFAIGFVLATISQLTLIGLGAIGISLALIY
LALSKQG

>7xno-a1-m1-cY (length=247) [Search sequence]

Structure information

PDB ID	7xno (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM structure of the bacteriocin-receptor-immunity ternary complex from Lactobacillus sakei
Assembly ID	1
Resolution	2.54Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	42
Sequence identity between the two chains	1.0
PubMed citation	35703550

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	Y
UniProt accession	Q38YH6	Q38YH6
Species	1634 (Latilactobacillus sakei L45)	1634 (Latilactobacillus sakei L45)
Function annotation	BioLiP:7xnoH	BioLiP:7xnoY

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7xno-a1-m1-cH_7xno-a1-m1-cY.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7xno-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7xno/1/1:D/1:H 7xno/1/1:D/1:Y