7xqp/1/1:a/1:b

Sequences

>7xqp-a1-m1-ca (length=218) [Search sequence]

SIWYGADRPKYLGPFSGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAM
LGALGCLTPELLAKSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVV
LMGAVEGYRVAGGPLGEITDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFG
FFVQAIVTGKGPLENLNDHLADPVANNAWAYATNFVPG

>7xqp-a1-m1-cb (length=218) [Search sequence]

Structure information

PDB ID	7xqp (database links: RCSB PDB PDBe PDBj PDBsum)
Title	PSI-LHCI-LHCII-Lhcb9 supercomplex of Physcomitrella patens
Assembly ID	1
Resolution	2.68Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	43
Sequence identity between the two chains	1.0
PubMed citation	37095225

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	a	b
UniProt accession	A9RT62	A9RT62
Species	3218 (Physcomitrium patens)	3218 (Physcomitrium patens)
Function annotation	BioLiP:7xqpa	BioLiP:7xqpb

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7xqp-a1-m1-ca_7xqp-a1-m1-cb.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7xqp-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7xqp/1/1:a/1:c 7xqp/1/1:b/1:c