7xuy/1/5:A/6:A

Sequences
>7xuy-a1-m5-cA (length=64) [Search sequence]
PFAQIYILEGRTPEQKKAVIEKVTQALHEATDAKKETIRVWIHEMPKENWGIAGVSAKDL
GRLE
>7xuy-a1-m6-cA (length=64) [Search sequence]
PFAQIYILEGRTPEQKKAVIEKVTQALHEATDAKKETIRVWIHEMPKENWGIAGVSAKDL
GRLE
Structure information
PDB ID 7xuy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of 5-chloro-2-hydroxymuconate tautomerase CnbG
Assembly ID 1
Resolution 2.001Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 5 6
Chain ID A A
UniProt accession Q38M36 Q38M36
Species 543891 (Comamonas testosteroni CNB-1) 543891 (Comamonas testosteroni CNB-1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7xuy-a1-m5-cA_7xuy-a1-m6-cA.pdb.gz
Full biological assembly
Download: 7xuy-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7xuy/1/1:A/2:A 7xuy/1/1:A/3:A 7xuy/1/2:A/3:A 7xuy/1/4:A/5:A 7xuy/1/4:A/6:A
Other dimers with similar sequences but different poses
  • 7xuy/1/3:A/6:A 7xuy/1/1:A/5:A 7xuy/1/2:A/4:A
  • [Back to Home]