7xx1/1/1:D/1:A

Sequences

>7xx1-a1-m1-cD (length=119) [Search sequence]

TASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRKMKDLSPRWYFYYLG TGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYA

>7xx1-a1-m1-cA (length=125) [Search sequence]

TASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRW YFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLP KGFYA

Structure information

PDB ID	7xx1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of SARS-CoV-2 N-NTD
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	42
Sequence identity between the two chains	1.0
PubMed citation	36317101

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	P0DTC9	P0DTC9
Species	2697049 (Severe acute respiratory syndrome coronavirus 2)	2697049 (Severe acute respiratory syndrome coronavirus 2)
Function annotation	BioLiP:7xx1D	BioLiP:7xx1A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7xx1-a1-m1-cD_7xx1-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7xx1-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	6vyo/1/1:A/1:D 6vyo/1/1:B/1:C 6wkp/1/1:B/1:C 7xx1/1/1:B/1:C
Other dimers with similar sequences but different poses	7xx1/1/1:D/1:C 6vyo/1/1:A/1:B 6vyo/1/1:C/1:D 6wkp/1/1:D/1:C 7xx1/1/1:A/1:B