7y7a/1/1:Mm/1:mm

Sequences
>7y7a-a1-m1-cMm (length=42) [Search sequence]
GGMSVSFPAYLAVLLGTFVPVAFLVILYIQSEARKAGASSKS
>7y7a-a1-m1-cmm (length=42) [Search sequence]
GGMSVSFPAYLAVLLGTFVPVAFLVILYIQSEARKAGASSKS
Structure information
PDB ID 7y7a (database links: RCSB PDB PDBe PDBj PDBsum)
Title In situ double-PBS-PSII-PSI-LHCs megacomplex from Porphyridium purpureum.
Assembly ID 1
Resolution 4.3Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 56
Sequence identity between the two chains 1.0
PubMed citation 36922595
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID Mm mm
UniProt accession A0A5J4YYD7 A0A5J4YYD7
Species 35688 (Porphyridium purpureum) 35688 (Porphyridium purpureum)
Function annotation BioLiP:7y7aMm
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7y7a-a1-m1-cMm_7y7a-a1-m1-cmm.pdb.gz
Full biological assembly
Download: 7y7a-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7y5e/1/1:M6/1:m6 7y5e/1/1:ML/1:mL 7y7a/1/1:M9/1:m9 7y7a/1/1:ME/1:mE 7y7a/1/1:MO/1:mO 7y7a/1/1:MZ/1:mZ

[Back to Home]