7ye8/2/1:C/1:D

Sequences
>7ye8-a2-m1-cC (length=75) [Search sequence]
ALRLVDPQIQLAVTVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLA
TTEELPDEFVVVTVK
>7ye8-a2-m1-cD (length=78) [Search sequence]
HPALRLVDPQIQLAVTRMVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQM
TKLATTEELPDEFVVVTV
Structure information
PDB ID 7ye8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of SARS-CoV-2 refolded dimeric ORF9b
Assembly ID 2
Resolution 3.01Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 106
Sequence identity between the two chains 0.987
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P0DTD2 P0DTD2
Species 2697049 (Severe acute respiratory syndrome coronavirus 2) 2697049 (Severe acute respiratory syndrome coronavirus 2)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7ye8-a2-m1-cC_7ye8-a2-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7ye8-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6z4u/1/1:B/1:A 7ye8/1/1:A/1:B

[Back to Home]