7ye8/2/1:C/1:D

Sequences

>7ye8-a2-m1-cC (length=75) [Search sequence]

ALRLVDPQIQLAVTVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLA TTEELPDEFVVVTVK

>7ye8-a2-m1-cD (length=78) [Search sequence]

HPALRLVDPQIQLAVTRMVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQM TKLATTEELPDEFVVVTV

Structure information

PDB ID	7ye8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of SARS-CoV-2 refolded dimeric ORF9b
Assembly ID	2
Resolution	3.01Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	106
Sequence identity between the two chains	0.987

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	P0DTD2	P0DTD2
Species	2697049 (Severe acute respiratory syndrome coronavirus 2)	2697049 (Severe acute respiratory syndrome coronavirus 2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7ye8-a2-m1-cC_7ye8-a2-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7ye8-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6z4u/1/1:B/1:A 7ye8/1/1:A/1:B