7yfv/2/1:D/1:C

Sequences
>7yfv-a2-m1-cD (length=47) [Search sequence]
SVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVN
>7yfv-a2-m1-cC (length=48) [Search sequence]
SVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVND
Structure information
PDB ID 7yfv (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Rpgrip1l CC1
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession Q8CG73 Q8CG73
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7yfv-a2-m1-cD_7yfv-a2-m1-cC.pdb.gz
Full biological assembly
Download: 7yfv-assembly2.cif.gz
Similar dimers

[Back to Home]