7yml/1/1:N/1:J

Sequences
>7yml-a1-m1-cN (length=43) [Search sequence]
LSFTGLTDEQAQELHAVYMSGLSAFIAVAVLAHLAVMIWRPWF
>7yml-a1-m1-cJ (length=44) [Search sequence]
DLSFTGLTDEQAQELHAVYMSGLSAFIAVAVLAHLAVMIWRPWF
Structure information
PDB ID 7yml (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of photosynthetic LH1-RC super-complex of Rhodobacter capsulatus
Assembly ID 1
Resolution 2.6Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 36792596
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID N J
UniProt accession P02950 P02950
Species 1061 (Rhodobacter capsulatus) 1061 (Rhodobacter capsulatus)
Function annotation BioLiP:7ymlN BioLiP:7ymlJ
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7yml-a1-m1-cN_7yml-a1-m1-cJ.pdb.gz
Full biological assembly
Download: 7yml-assembly1.cif.gz

[Back to Home]