7yot/1/1:C/1:D

Sequences
>7yot-a1-m1-cC (length=42) [Search sequence]
SEIQQLKTSVAVMEANLGMMKILDPGCANVSSLSDLRAVAKS
>7yot-a1-m1-cD (length=51) [Search sequence]
MRSEIQQLKTSVAVMEANLGMMKILDPGCANVSSLSDLRAVAKSHPVLIAG
Structure information
PDB ID 7yot (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cryo-EM structure of RNA polymerase in complex with P protein tetramer of Newcastle disease virus
Assembly ID 1
Resolution 3.0Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 62
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession A0A0S2UXI9 A0A0S2UXI9
Species 2560319 (Avian orthoavulavirus 1) 2560319 (Avian orthoavulavirus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7yot-a1-m1-cC_7yot-a1-m1-cD.pdb.gz
Full biological assembly
Download: 7yot-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7you/1/1:C/1:D 7yov/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 7you/1/1:B/1:C 7yot/1/1:B/1:C
  • 7you/1/1:B/1:D 7yot/1/1:B/1:D
  • [Back to Home]