7you/1/1:B/1:C

Sequences
>7you-a1-m1-cB (length=41) [Search sequence]
TMRSEIQQLKTSVAVMEANLGMMKILDPGCANVSSLSDLRA
>7you-a1-m1-cC (length=47) [Search sequence]
IPTMRSEIQQLKTSVAVMEANLGMMKILDPGCANVSSLSDLRAVAKS
Structure information
PDB ID 7you (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cryo-EM structure of RNA polymerase in complex with P protein tetramer of Newcastle disease virus
Assembly ID 1
Resolution 3.41Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession A0A0S2UXI9 A0A0S2UXI9
Species 2560319 (Avian orthoavulavirus 1) 2560319 (Avian orthoavulavirus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7you-a1-m1-cB_7you-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7you-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 7you/1/1:B/1:D 7yot/1/1:B/1:D
  • 7yot/1/1:C/1:D 7you/1/1:C/1:D 7yov/1/1:C/1:D
    		•

    [Back to Home]