7yrt/5/1:I/1:G

Sequences
>7yrt-a5-m1-cI (length=114) [Search sequence]
QHSHLDSLEDQVERYKQVLDVMPAGVILLDTQGIVREANPEAQRLLDVPLVGEKWYSVIQ
IAFAPRDDDGHEISLRNGRKVRLAISASTTGQLILITDLTETRLLQSRISDLQR
>7yrt-a5-m1-cG (length=115) [Search sequence]
QHSHLDSLEDQVERYKQVLDVMPAGVILLDTQGIVREANPEAQRLLDVPLVGEKWYSVIQ
IAFAPRDDDGHEISLRNGRKVRLAISASTTGQLILITDLTETRLLQSRISDLQRL
Structure information
PDB ID 7yrt (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of PAS like domain of FlrB, the histidine kinase involved in flagellar synthesis of Vibrio cholerae
Assembly ID 5
Resolution 2.27Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 140
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I G
UniProt accession H9L4P6 H9L4P6
Species 127906 (Vibrio cholerae O1) 127906 (Vibrio cholerae O1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7yrt-a5-m1-cI_7yrt-a5-m1-cG.pdb.gz
Full biological assembly
Download: 7yrt-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7yrt/1/1:A/1:E 7yrt/2/1:B/1:F 7yrt/3/1:K/1:C 7yrt/4/1:L/1:D 7yrt/6/1:J/1:H

[Back to Home]