7ysh/1/1:E/1:D

Sequences

>7ysh-a1-m1-cE (length=212) [Search sequence]

RMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYK
VRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTV
ALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLH
LRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVL

>7ysh-a1-m1-cD (length=213) [Search sequence]

Structure information

PDB ID	7ysh (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM Structure of FGF23-FGFR1c-aKlotho-HS Quaternary Complex
Assembly ID	1
Resolution	2.74Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	67
Sequence identity between the two chains	1.0
PubMed citation	37286607

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	D
UniProt accession	P11362-20	P11362-20
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7yshE	BioLiP:7yshD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7ysh-a1-m1-cE_7ysh-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7ysh-assembly1.cif.gz