7ysu/1/1:E/1:C

Sequences

>7ysu-a1-m1-cE (length=210) [Search sequence]

TGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLR
HQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVL
GSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLH
NVTFEDAGEYTCLAGNSIGFSHHSAWLVVL

>7ysu-a1-m1-cC (length=211) [Search sequence]

Structure information

PDB ID	7ysu (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM Structure of FGF23-FGFR3c-aKlotho-HS Quaternary Complex
Assembly ID	1
Resolution	3.2Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	59
Sequence identity between the two chains	1.0
PubMed citation	37286607

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	C
UniProt accession	P22607	P22607
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7ysuE	BioLiP:7ysuC

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7ysu-a1-m1-cE_7ysu-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7ysu-assembly1.cif.gz