7z5k/1/1:A/1:B

Sequences
>7z5k-a1-m1-cA (length=56) [Search sequence]
SMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQE
>7z5k-a1-m1-cB (length=56) [Search sequence]
MDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQEL
Structure information
PDB ID 7z5k (database links: RCSB PDB PDBe PDBj PDBsum)
Title Transcription factor MYF5 bound to non-symmetrical site
Assembly ID 1
Resolution 2.28Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 50
Sequence identity between the two chains 0.982
PubMed citation 39753777
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P13349 P13349
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7z5kA BioLiP:7z5kB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7z5k-a1-m1-cA_7z5k-a1-m1-cB.pdb.gz
Full biological assembly
Download: 7z5k-assembly1.cif.gz
Similar dimers

[Back to Home]