7z8f/1/1:s/1:t

Sequences

>7z8f-a1-m1-cs (length=93) [Search sequence]

EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDP QNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT

>7z8f-a1-m1-ct (length=93) [Search sequence]

EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDP QNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT

Structure information

PDB ID	7z8f (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Composite structure of dynein-dynactin-BICDR on microtubules
Assembly ID	1
Resolution	20.0Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	52
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	s	t
UniProt accession	Q9NP97	Q9NP97
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7z8f-a1-m1-cs_7z8f-a1-m1-ct.pdb.gz

Full biological assembly Download: 7z8f-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1z09/1/1:A/1:B 2b95/1/1:A/1:B 6f1t/1/1:k/1:l 6f1t/1/1:s/1:t 6f1z/1/1:s/1:t 6f38/1/1:s/1:t 6f3a/1/1:k/1:l 6rlb/1/1:G/1:H 6sc2/1/1:G/1:H 7z8f/1/1:k/1:l
Other dimers with similar sequences but different poses	2e8j/1/1:A/1:B 1y4o/1/1:A/1:B