7zc3/1/1:A/1:B

Sequences
>7zc3-a1-m1-cA (length=67) [Search sequence]
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKT
VSYLGLE
>7zc3-a1-m1-cB (length=67) [Search sequence]
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKT
VSYLGLE
Structure information
PDB ID 7zc3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human copper chaperone Atox1 bound to zinc ion by CxxC motif
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
PubMed citation 36291703
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession O00244 O00244
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7zc3A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7zc3-a1-m1-cA_7zc3-a1-m1-cB.pdb.gz
Full biological assembly
Download: 7zc3-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1fe0/1/1:A/1:B 1fe4/1/1:A/1:B 1fee/1/1:A/1:B 3iwx/1/1:A/1:B 4qot/1/1:A/1:B 4yea/1/1:A/1:B

[Back to Home]