7ze3/1/1:O/1:Q

Sequences
>7ze3-a1-m1-cO (length=47) [Search sequence]
NQGRIWTVVKPTVGLPLLLGSVAIMVFLVHFAVLTHTTWVAKFMNGK
>7ze3-a1-m1-cQ (length=47) [Search sequence]
NQGRIWTVVKPTVGLPLLLGSVAIMVFLVHFAVLTHTTWVAKFMNGK
Structure information
PDB ID 7ze3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title PucD-LH2 complex from Rps. palustris
Assembly ID 1
Resolution 2.7Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
PubMed citation 36251992
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID O Q
UniProt accession P35104 P35104
Species 1076 (Rhodopseudomonas palustris) 1076 (Rhodopseudomonas palustris)
Function annotation BioLiP:7ze3O BioLiP:7ze3Q
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7ze3-a1-m1-cO_7ze3-a1-m1-cQ.pdb.gz
Full biological assembly
Download: 7ze3-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7ze3/1/1:A/1:C 7ze3/1/1:A/1:Q 7ze3/1/1:C/1:E 7ze3/1/1:E/1:G 7ze3/1/1:G/1:I 7ze3/1/1:I/1:K 7ze3/1/1:K/1:M 7ze3/1/1:M/1:O

[Back to Home]