7zj3/2/1:G/1:A

Sequences
>7zj3-a2-m1-cG (length=85) [Search sequence]
PSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSI
LPEKGVAALQNNFFITNLMDVLQRT
>7zj3-a2-m1-cA (length=86) [Search sequence]
PSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSI
LPEKGVAALQNNFFITNLMDVLQRTP
Structure information
PDB ID 7zj3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of TRIM2 RING domain in complex with UBE2D1~Ub conjugate
Assembly ID 2
Resolution 2.53Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
PubMed citation 36481767
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G A
UniProt accession Q9C040 Q9C040
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7zj3G BioLiP:7zj3A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7zj3-a2-m1-cG_7zj3-a2-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7zj3-assembly2.cif.gz
Similar dimers

[Back to Home]