7zxy/1/1:A/1:I

Sequences

>7zxy-a1-m1-cA (length=220) [Search sequence]

SKEVTESKVFQWFNDRLEVQAISDDIASKYVPPHVNIFYCLGGLTLTCFLIQFATGFAMT
FYYKPTVTEAFASVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRE
LTWVVGVMLAVTTVTFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDQLVTLMRGSESV
GQATLTRFYSLHTFVLPWAIAVLLLLHFLMIRKQGISGPL

>7zxy-a1-m1-cI (length=220) [Search sequence]

Structure information

PDB ID	7zxy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	3.15 Angstrom cryo-EM structure of the dimeric cytochrome b6f complex from Synechocystis sp. PCC 6803 with natively bound plastoquinone and lipid molecules.
Assembly ID	1
Resolution	3.15Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	73
Sequence identity between the two chains	1.0
PubMed citation	35726684

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	I
UniProt accession	Q57038	Q57038
Species	1148 (Synechocystis sp. PCC 6803)	1148 (Synechocystis sp. PCC 6803)
Function annotation	BioLiP:7zxyA	BioLiP:7zxyI

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7zxy-a1-m1-cA_7zxy-a1-m1-cI.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7zxy-assembly1.cif.gz

Similar dimers