7zyj/1/1:H/1:h

Sequences

>7zyj-a1-m1-cH (length=229) [Search sequence]

TTILAVSYNGGVVLAADSRTSSGTYVVNRASNKLTKLTKKIYCCRSGSAADTQALAERVS
NYLGSYQTDIGAGVNVATAANLFQKMCYMNRWNISAGIIVAGYDPINGGSVYSIPSGGSC
VKLDYALGGSGSIFLYSFFDANYKPGMSKSECVAFCQRAVAHAYSRDGSSGGLIRTITLD
ADEPEDQTIPWNRSPYCMEKDPKYVTQATQNQPFSSSAKITGNRMSSTG

>7zyj-a1-m1-ch (length=229) [Search sequence]

Structure information

PDB ID	7zyj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Leishmania tarentolae proteasome 20S subunit in complex with compound 2
Assembly ID	1
Resolution	2.7Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	84
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	h
UniProt accession	A0A640KBR2	A0A640KBR2
Species	5689 (Leishmania tarentolae)	5689 (Leishmania tarentolae)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7zyj-a1-m1-cH_7zyj-a1-m1-ch.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7zyj-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6qm7/1/1:H/1:V 6qm8/1/1:H/1:V 6tcz/1/1:H/1:h 6td5/1/1:H/1:h