8a0w/1/1:A/1:B

Sequences
>8a0w-a1-m1-cA (length=68) [Search sequence]
ELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPE
TLSHIAEL
>8a0w-a1-m1-cB (length=68) [Search sequence]
ELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPE
TLSHIAEL
Structure information
PDB ID 8a0w (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the HigA2 antitoxin in complex with operator DNA
Assembly ID 1
Resolution 2.334Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 63
Sequence identity between the two chains 1.0
PubMed citation 38600130
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9KMA5 Q9KMA5
Species 666 (Vibrio cholerae) 666 (Vibrio cholerae)
Function annotation BioLiP:8a0wA BioLiP:8a0wB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 8a0w-a1-m1-cA_8a0w-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 8a0w-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 5j9i/4/1:G/1:H 5j9i/1/1:A/1:B 5j9i/2/1:D/1:C 5j9i/3/1:E/1:F 5jaa/1/1:B/1:A
  • [Back to Home]