8a8q/1/1:C/1:D

Sequences

>8a8q-a1-m1-cC (length=41) [Search sequence]

GHQIVHVRGDSETDLEALFNAVNPQTVPRLRKLPDSFFKPP

>8a8q-a1-m1-cD (length=42) [Search sequence]

GHQIVHVRGDSETDLEALFNAVNPKQTVPRLRKLPDSFFKPP

Structure information

PDB ID	8a8q (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Protein Scalloped in complex with YAP peptide
Assembly ID	1
Resolution	1.465Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	P46937	P46937
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 8a8q-a1-m1-cC_8a8q-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 8a8q-assembly1.cif.gz