8a9m/1/4:B/1:A

Sequences
>8a9m-a1-m4-cB (length=108) [Search sequence]
DNILYSGETLSPGESLNYGPYTFIMQQDCNLVLYDVDKPIWASNTGGLAQGCHLSMQSDG
NLVVYSPSGNRIWASNTQGENGNYVCIVQKDRNVVIYGTARWATGTNI
>8a9m-a1-m1-cA (length=108) [Search sequence]
DNILYSGETLSPGESLNYGPYTFIMQQDCNLVLYDVDKPIWASNTGGLAQGCHLSMQSDG
NLVVYSPSGNRIWASNTQGENGNYVCIVQKDRNVVIYGTARWATGTNI
Structure information
PDB ID 8a9m (database links: RCSB PDB PDBe PDBj PDBsum)
Title Hippeastrum hybrid agglutinin, HHA, complex with beta-mannose
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 1
Chain ID B A
UniProt accession Q7Y041 Q7Y041
Species 679627 (Hippeastrum hybrid cultivar) 679627 (Hippeastrum hybrid cultivar)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 8a9m-a1-m4-cB_8a9m-a1-m1-cA.pdb.gz
Full biological assembly
Download: 8a9m-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 8a9m/1/4:B/3:B 8a9m/1/1:A/2:A
  • [Back to Home]