8ad9/2/1:C/1:B

Sequences
>8ad9-a2-m1-cC (length=2) [Search sequence]
AV
>8ad9-a2-m1-cB (length=151) [Search sequence]
SENLYFQGFRRFTPRARNAVVAAQNAAHGAASSEITPDHLLLGVLTDPAALATALLQQQE
IDIATLRTAVTLPPAVTEPPQPIPFSGPARKVLELTFREALRLGHNYIGTEHLLLALLEL
EDGDGPLHRSGVDKSRAEADLITTLASLTGA
Structure information
PDB ID 8ad9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of ClpC2 C-terminal domain
Assembly ID 2
Resolution 1.43Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 36944713
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession P9WPC7
Species 32630 (synthetic construct) 83332 (Mycobacterium tuberculosis H37Rv)
Function annotation BioLiP:8ad9B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 8ad9-a2-m1-cC_8ad9-a2-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 8ad9-assembly2.cif.gz

[Back to Home]