8ae2/1/1:B/1:I

Sequences

>8ae2-a1-m1-cB (length=97) [Search sequence]

EMNPNVNVFVPPRDGFKSKLICEATNFTPKPITVSWLKDGKLVESGFTTDPVTIEQTYKV ISTLTISEIDWLNLNVYTCRVDHRGLTFLKNVSSTCA

>8ae2-a1-m1-cI (length=106) [Search sequence]

VAEMNPNVNVFVPPRDGFSGPAPRKSKLICEATNFTPKPITVSWLKDGKLVESGFTTDPV TIETPQTYKVISTLTISEIDWLNLNVYTCRVDHRGLTFLKNVSSTC

Structure information

PDB ID	8ae2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM structure of full-length human immunoglobulin M - F(ab')2 conformation 5
Assembly ID	1
Resolution	8.5Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	51
Sequence identity between the two chains	0.99

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	I
UniProt accession
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 8ae2-a1-m1-cB_8ae2-a1-m1-cI.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 8ae2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

8adz/1/1:B/1:I 8ae0/1/1:B/1:I