8axk/1/1:I/1:J

Sequences
>8axk-a1-m1-cI (length=63) [Search sequence]
MSDIVYMGNKALYLILIFSLWPVGIPFGIKLIGVSISLLLLSGWYGEVLLSFCHEIMFLI
KSG
>8axk-a1-m1-cJ (length=67) [Search sequence]
MSDIVYMGNKALYLILIFSLWPVGIATVLPFGIKLIGVSISLLLLSGWYGEVLLSFCHEI
MFLIKSG
Structure information
PDB ID 8axk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Type 3 secretion system export apparatus core, inner rod and needle of Shigella flexneri
Assembly ID 1
Resolution 4.05Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
PubMed citation 36790757
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I J
UniProt accession P0A1M4 P0A1M4
Species 623 (Shigella flexneri) 623 (Shigella flexneri)
Function annotation BioLiP:8axkI BioLiP:8axkJ
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 8axk-a1-m1-cI_8axk-a1-m1-cJ.pdb.gz
Full biological assembly
Download: 8axk-assembly1.cif.gz
Similar dimers

[Back to Home]