8axk/1/1:M/1:R

Sequences
>8axk-a1-m1-cM (length=42) [Search sequence]
ESLNPESLAKLQTTLSNYSIGVSLAGTLARKTVSAVETLLKS
>8axk-a1-m1-cR (length=85) [Search sequence]
NQVDIIKASDFQSLEDVVSAKYSDIKMDTDIQVSQIMEMVSNPESLNPESLAKLQTTLSN
YSIGVSLAGTLARKTVSAVETLLKS
Structure information
PDB ID 8axk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Type 3 secretion system export apparatus core, inner rod and needle of Shigella flexneri
Assembly ID 1
Resolution 4.05Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID M R
UniProt accession P0A225 P0A225
Species 623 (Shigella flexneri) 623 (Shigella flexneri)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 8axk-a1-m1-cM_8axk-a1-m1-cR.pdb.gz
Full biological assembly
Download: 8axk-assembly1.cif.gz

[Back to Home]