8bny/1/1:A/1:D

Sequences
>8bny-a1-m1-cA (length=35) [Search sequence]
VIRFFDVTGLSEKDIERVKEEIELLKIRNEYMKLK
>8bny-a1-m1-cD (length=36) [Search sequence]
SVIRFFDVTGLSEKDIERVKEEIELLKIRNEYMKLK
Structure information
PDB ID 8bny (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the tetramerization domain of pLS20 conjugation repressor Rco
Assembly ID 1
Resolution 1.429Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A D
UniProt accession E9RIY8 E9RIY8
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 8bny-a1-m1-cA_8bny-a1-m1-cD.pdb.gz
Full biological assembly
Download: 8bny-assembly1.cif.gz
Similar dimers

[Back to Home]