8c9t/2/1:B/1:C

Sequences

>8c9t-a2-m1-cB (length=221) [Search sequence]

SQQLWDDVDDYFTTLLAPEDEALTAALRDSDAAGLPHINVAPNQGKLLQLLAEIQGARRI
LEIGTLGGYSTIWLGRALPRDGRLISFEYDAKHAEVARRNLARAGLDGISEVRVGPALES
LPKLADERPEPFDLVFIDADKVNNPHYVEWALKLTRPGSLIVVDNVVRGGGVTDAGSTDP
SVRGTRSALELIAEHPKLSGTAVQTVGSKGYDGFALARVLP

>8c9t-a2-m1-cC (length=228) [Search sequence]

Structure information

PDB ID	8c9t (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Catechol O-methyltransferase from Streptomyces avermitilis
Assembly ID	2
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	122
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q82B68	Q82B68
Species	227882 (Streptomyces avermitilis MA-4680 = NBRC 14893)	227882 (Streptomyces avermitilis MA-4680 = NBRC 14893)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	8c9t-a2-m1-cB_8c9t-a2-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	8c9t-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

8c9s/1/1:A/1:B 8c9t/1/1:D/1:A