8cwr/1/2:B/3:B

Sequences

>8cwr-a1-m2-cB (length=109) [Search sequence]

AHHHHHHVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGV TRERIRQIESKTMSKLRHPSRSQVLRDYLDGSSGSGTPEERLLRAIFGE

>8cwr-a1-m3-cB (length=109) [Search sequence]

AHHHHHHVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGV TRERIRQIESKTMSKLRHPSRSQVLRDYLDGSSGSGTPEERLLRAIFGE

Structure information

PDB ID	8cwr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Complex structure of WhiB3 and the SigmaAr4-RNAP Beta flap tip chimera in space group R3
Assembly ID	1
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	60
Sequence identity between the two chains	1.0
PubMed citation	37142222

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	B	B
UniProt accession	P9WGY9	P9WGY9
Species	83332 (Mycobacterium tuberculosis H37Rv)	83332 (Mycobacterium tuberculosis H37Rv)
Function annotation	BioLiP:8cwrB	BioLiP:8cwrB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 8cwr-a1-m2-cB_8cwr-a1-m3-cB.pdb.gz

Full biological assembly Download: 8cwr-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

8cwr/1/1:B/2:B 8cwr/1/1:B/3:B 8cwt/1/1:B/1:D 8cwt/1/1:B/1:F 8cwt/1/1:D/1:F