8cx9/4/1:H/1:J

Sequences
>8cx9-a4-m1-cH (length=74) [Search sequence]
MQISVKTLMRKRITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFSGMLLEDGRTLSDYN
IQKGSTLTLGLILR
>8cx9-a4-m1-cJ (length=74) [Search sequence]
MQISVKTLMRKRITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFSGMLLEDGRTLSDYN
IQKGSTLTLGLILR
Structure information
PDB ID 8cx9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the SARS-COV2 PLpro (C111S) in complex with a dimeric Ubv that inhibits activity by an unusual allosteric mechanism
Assembly ID 4
Resolution 3.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 131
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H J
UniProt accession P62987 P62987
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 8cx9-a4-m1-cH_8cx9-a4-m1-cJ.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 8cx9-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 8cx9/1/1:F/1:G 8cx9/2/1:E/1:I 8cx9/3/1:K/1:L

[Back to Home]