8d05/1/1:A/2:A

Sequences
>8d05-a1-m1-cA (length=60) [Search sequence]
PIVIDLNKTIERDGRKVKLVRATITVDPETNTITIDIEYEGGPITKEDLLEAFKLAASKL
>8d05-a1-m2-cA (length=60) [Search sequence]
PIVIDLNKTIERDGRKVKLVRATITVDPETNTITIDIEYEGGPITKEDLLEAFKLAASKL
Structure information
PDB ID 8d05 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Hallucinated C2 protein assembly HALC2_065
Assembly ID 1
Resolution 2.51Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 76
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 8d05-a1-m1-cA_8d05-a1-m2-cA.pdb.gz
Full biological assembly
Download: 8d05-assembly1.cif.gz

[Back to Home]