8dfk/1/1:A/1:B

Sequences

>8dfk-a1-m1-cA (length=64) [Search sequence]

NETIVIDIKGAVQHPGVYEMRTGDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIP KKGE

>8dfk-a1-m1-cB (length=64) [Search sequence]

NETIVIDIKGAVQHPGVYEMRTGDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIP KKGE

Structure information

PDB ID	8dfk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-ray crystal structure of Bacillus subtilis ComEA
Assembly ID	1
Resolution	3.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	26
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P39694	P39694
Species	224308 (Bacillus subtilis subsp. subtilis str. 168)	224308 (Bacillus subtilis subsp. subtilis str. 168)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 8dfk-a1-m1-cA_8dfk-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 8dfk-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

8dfk/2/1:C/1:D 8dfk/3/1:E/1:F 8dfk/4/1:G/1:F