8dgl/1/1:C/1:D

Sequences

>8dgl-a1-m1-cC (length=67) [Search sequence]

MDDENDRAARAKKGSPFLNTAQAAFYIGLSQRTLEKMRLTGGGPKYRKHGRYVRYHIDEL DDWSKGR

>8dgl-a1-m1-cD (length=67) [Search sequence]

MDDENDRAARAKKGSPFLNTAQAAFYIGLSQRTLEKMRLTGGGPKYRKHGRYVRYHIDEL DDWSKGR

Structure information

PDB ID	8dgl (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the RdfS Excisionase
Assembly ID	1
Resolution	2.45Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	61
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q7AL96	Q7AL96
Species	935547 (Mesorhizobium japonicum R7A)	935547 (Mesorhizobium japonicum R7A)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 8dgl-a1-m1-cC_8dgl-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 8dgl-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

8dgl/1/1:A/1:B 8dgl/1/1:C/1:B