8eqm/1/1:M/1:m

Sequences
>8eqm-a1-m1-cM (length=31) [Search sequence]
METNKLGFVASVLFVFVPTVFLLILYIQTAS
>8eqm-a1-m1-cm (length=31) [Search sequence]
METNKLGFVASVLFVFVPTVFLLILYIQTAS
Structure information
PDB ID 8eqm (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a dimeric photosystem II complex acclimated to far-red light
Assembly ID 1
Resolution 2.6Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID M m
UniProt accession
Species 91464 (Synechococcus sp. PCC 7335) 91464 (Synechococcus sp. PCC 7335)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 8eqm-a1-m1-cM_8eqm-a1-m1-cm.pdb.gz
Full biological assembly
Download: 8eqm-assembly1.cif.gz

[Back to Home]