8es9/1/1:Y/1:Z

Sequences
>8es9-a1-m1-cY (length=31) [Search sequence]
GLLDPKLCYLLDGILFIYGVILTALFLRVKF
>8es9-a1-m1-cZ (length=36) [Search sequence]
QSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSR
Structure information
PDB ID 8es9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title CryoEM structure of PN45428 TCR-CD3 in complex with HLA-A2 MAGEA4
Assembly ID 1
Resolution 3.25Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
PubMed citation 37100770
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID Y Z
UniProt accession P20963 P20963
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:8es9Y
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 8es9-a1-m1-cY_8es9-a1-m1-cZ.pdb.gz
Full biological assembly
Download: 8es9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6jxr/1/1:b/1:a 7fjd/1/1:b/1:a 7fje/1/1:b/1:a 7fjf/1/1:b/1:a 7phr/1/1:z/1:Z 8es7/1/1:Y/1:Z 8es8/1/1:Y/1:Z

[Back to Home]