8f0l/1/1:H/1:A

Sequences

>8f0l-a1-m1-cH (length=211) [Search sequence]

VQLVQSGAEVKKPGASVKVSCKASGFNIKDYYMHWVRQAPGQRLEWMGWIDLENANTIYD
AKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCARDAYGRYFYDVWGQGTLVTVSSAS
TKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
TVPSSSLGTQTYICNVNHKPSNTKVDKKVEP

>8f0l-a1-m1-cA (length=211) [Search sequence]

Structure information

PDB ID	8f0l (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the Human T cell Receptor CD3(EPSILON) N-Terminal Peptide Complexed with ADI-26906 FAB
Assembly ID	1
Resolution	1.81Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	25
Sequence identity between the two chains	1.0
PubMed citation	36991534

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	A
UniProt accession
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:8f0lH	BioLiP:8f0lA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	8f0l-a1-m1-cH_8f0l-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	8f0l-assembly1.cif.gz