8f4v/1/1:D/1:E

Sequences

>8f4v-a1-m1-cD (length=264) [Search sequence]

LYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPSTSDSS
PSIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE
DKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM
ACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRL
CLMAFSVFTIICTIGILMSAPNFV

>8f4v-a1-m1-cE (length=264) [Search sequence]

Structure information

PDB ID	8f4v (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Alpha7 nicotinic acetylcholine receptor intracellular and transmembrane domains bound to ivermectin in a desensitized state
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	115
Sequence identity between the two chains	1.0
PubMed citation	36821490

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	E
UniProt accession	P36544	P36544
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:8f4vD	BioLiP:8f4vE

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	8f4v-a1-m1-cD_8f4v-a1-m1-cE.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	8f4v-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7rpm/1/1:A/1:B 7rpm/1/1:A/1:E 7rpm/1/1:B/1:C 7rpm/1/1:C/1:D 7rpm/1/1:D/1:E 8f4v/1/1:A/1:B 8f4v/1/1:A/1:E 8f4v/1/1:B/1:C 8f4v/1/1:C/1:D