8g28/1/2:B/2:A

Sequences
>8g28-a1-m2-cB (length=103) [Search sequence]
DVLSALQKSIRGSDVDASLHYTARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTA
LDAAQKIGFPEARILIANVVIDLALSPKSNSAYVADKALADLK
>8g28-a1-m2-cA (length=107) [Search sequence]
GHYDVLSALQKSIRGSDVDASLHYTARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHT
VTALDAAQKIGFPEARILIANVVIDLALSPKSNSAYVADKALADLKT
Structure information
PDB ID 8g28 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the C-terminal Fragment of AAA ATPase from Streptococcus pneumoniae.
Assembly ID 1
Resolution 1.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession A0A0H2URL5 A0A0H2URL5
Species 170187 (Streptococcus pneumoniae TIGR4) 170187 (Streptococcus pneumoniae TIGR4)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 8g28-a1-m2-cB_8g28-a1-m2-cA.pdb.gz
Full biological assembly
Download: 8g28-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 8g28/1/1:B/1:A 8g28/1/1:B/2:A 8g28/1/2:B/1:A

[Back to Home]